| Edit |   |
|---|
| Antigenic Specificity | FBXO46 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FBXO46 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FBXO46. This antibody reacts with human. The FBXO46 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FBXO46 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YPRPTTPAPVVFVSAEQGGPAKGVGSERRSGGGDCSRVAEAVAHFEAQRDSPPTKGLRKEERPGPGPGEVRIAFRISNG |
|---|
| Other Names | F-box only protein 46,20D7-FC4, F-box protein 46, Fbx46, FBXO34L |
|---|
| Gene, Accession # | FBXO46, Gene ID: 23403, Accession: Q6PJ61, SwissProt: Q6PJ61 |
|---|
| Catalog # | NBP2-31891 |
|---|
| Price | |
|---|
| Order / More Info | FBXO46 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|