| 产品详情 |
| Edit |   |
| Antigenic Specificity | WBP11 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The WBP11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WBP11. This antibody reacts with human. The WBP11 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human WBP11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIPLPDMPHAPSNILIQDIPLPGAQPPSILKKTSAYGPPTRAVSILPLLGHGVPRLP |
| Other Names | DKFZp779M1063, Npw38-binding protein, Npw38-binding protein NpwBP, NpwBP, NPWBPsplicing factor, PQBP1 and PP1 interacting, SH3 domain-binding protein SNP70, SIPP1WW domain-binding protein 11, SNP70, Splicing factor that interacts with PQBP-1 and PP1, WBP-11, WW domain binding protein 11 |
| Gene, Accession # | WBP11, Gene ID: 51729 |
| Catalog # | NBP2-58142 |
| Price | |
| Order / More Info | WBP11 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|