| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | WBP11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WBP11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WBP11. This antibody reacts with human, mouse. The WBP11 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation. |
|---|
| Immunogen | Synthetic peptides corresponding to WBP11(WW domain binding protein 11) The peptide sequence was selected from the N terminal of WBP11. Peptide sequence GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK. |
|---|
| Other Names | DKFZp779M1063, Npw38-binding protein, Npw38-binding protein NpwBP, NpwBP, NPWBPsplicing factor, PQBP1 and PP1 interacting, SH3 domain-binding protein SNP70, SIPP1WW domain-binding protein 11, SNP70, Splicing factor that interacts with PQBP-1 and PP1, WBP-11, WW domain binding protein 11 |
|---|
| Gene, Accession # | WBP11, Gene ID: 51729, Accession: Q9Y2W2, SwissProt: Q9Y2W2 |
|---|
| Catalog # | NBP1-54648-20ul |
|---|
| Price | |
|---|
| Order / More Info | WBP11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|