| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ABH1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ABH1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABH1. This antibody reacts with human. The ABH1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ABH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDIS TEGFCHLDDQNSEVKRARIN |
|---|
| Other Names | ABH1, ABHalkB, alkylation repair homolog (E. coli), alkB, alkB, alkylation repair homolog 1 (E. coli), ALKBH, alkylated DNA repair protein alkB homolog 1, alkylation repair, alkB homolog, Alpha-ketoglutarate-dependent dioxygenase ABH1, DNA lyase ABH1, EC 1.14.11.-, EC 4.2.99.18, hABH |
|---|
| Gene, Accession # | ALKBH1, Gene ID: 8846, Accession: Q13686, SwissProt: Q13686 |
|---|
| Catalog # | NBP2-14283 |
|---|
| Price | |
|---|
| Order / More Info | ABH1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|