| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TIRAP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TIRAP Antibody from Novus Biologicals is a rabbit polyclonal antibody to TIRAP. This antibody reacts with human. The TIRAP Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TIRAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQML |
|---|
| Other Names | adapter protein wyatt, Adaptor protein Wyatt, MAL, MyD88 adapter-like protein, MyD88-2, TIR domain-containing adapter protein, toll/interleukin-1 receptor domain-containing adapter protein, toll-interleukin 1 receptor (TIR) domain containing adaptor protein, Toll-interleukin 1 receptor (TIR) domain-containing adaptor protein, Toll-like receptor adaptor protein, wyatt |
|---|
| Gene, Accession # | TIRAP, Gene ID: 114609 |
|---|
| Catalog # | NBP2-47605 |
|---|
| Price | |
|---|
| Order / More Info | TIRAP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|