| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ABHD11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ABHD11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABHD11. This antibody reacts with human. The ABHD11 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ABHD11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RFVWRVNLDALTQHLDKILAFPQRQESYLGPTLFLLGGNSQFVHPSHHPEIMRLFPRAQMQTVPNAGHWIHADRPQDFIAAIRGFLV |
|---|
| Other Names | abhydrolase domain containing 11, abhydrolase domain-containing protein 11, EC 3.-, PP1226, WBSCR21, Williams Beuren syndrome chromosome region 21, Williams-Beuren syndrome chromosomal region 21 protein |
|---|
| Gene, Accession # | ABHD11, Gene ID: 83451, Accession: Q8NFV4, SwissProt: Q8NFV4 |
|---|
| Catalog # | NBP2-33574 |
|---|
| Price | |
|---|
| Order / More Info | ABHD11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29248718 |
|---|
| 产品资料 |
|
|