| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Tissue alpha-L-Fucosidase/FUCA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Tissue alpha-L-Fucosidase/FUCA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tissue alpha-L-Fucosidase/FUCA1. This antibody reacts with human. The Tissue alpha-L-Fucosidase/FUCA1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Tissue alpha-L-Fucosidase/FUCA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIK |
|---|
| Other Names | Alpha-L-fucosidase 1, Alpha-L-fucosidase I, Alpha-L-fucoside fucohydrolase 1, EC 3.2.1, EC 3.2.1.51, FUCA, fucosidase, alpha-L- 1, tissue, tissue alpha-L-fucosidase |
|---|
| Gene, Accession # | FUCA1, Gene ID: 2517, Accession: P04066, SwissProt: P04066 |
|---|
| Catalog # | NBP2-32044 |
|---|
| Price | |
|---|
| Order / More Info | Tissue alpha-L-Fucosidase/FUCA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|