| 产品详情 |
| Edit |   |
| Antigenic Specificity | ABI1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ABI1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABI1. This antibody reacts with human. The ABI1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ABI1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQ |
| Other Names | Abelson interactor 1, ABI-1, abl interactor 1, Abl-binding protein 4, AblBP4, abl-interactor 1, Abl-interactor protein 1 long, E3B1, eps8 binding protein, Eps8 SH3 domain-binding protein, Eps8-binding protein, interactor protein AblBP4, nap1 binding protein, Nap1-binding protein, Nap1BP, spectrin SH3 domain binding protein 1, Spectrin SH3 domain-binding protein 1, SSH3BP, SSH3BP1 |
| Gene, Accession # | ABI1, Gene ID: 10006 |
| Catalog # | NBP2-57842 |
| Price | |
| Order / More Info | ABI1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|