| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ABI2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ABI2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABI2. This antibody reacts with human. The ABI2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ABI2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHT |
|---|
| Other Names | Abelson interactor 2, Abi-2, ABI2B, abl binding protein 3, abl interactor 2, Abl-binding protein 3, AblBP3ABI-2, abl-interacting protein 1 (SH3-containing protein), abl-interactor 2, abl-interactor protein 2b, AIP-1, arg protein tyrosine kinase-binding protein, Arg-binding protein 1, argBP1, ARGBPIA, argBPIB, SSH3BP2 |
|---|
| Gene, Accession # | ABI2, Gene ID: 10152 |
|---|
| Catalog # | NBP2-49637 |
|---|
| Price | |
|---|
| Order / More Info | ABI2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|