| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ABL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ABL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABL2. This antibody reacts with human. The ABL2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSF |
|---|
| Other Names | Abelson murine leukemia viral (v-abl) oncogene homolog 2, Abelson murine leukemia viral oncogene homolog 2, Abelson-related gene protein, Abelson-relatedgene), arg tyrosine kinase, EC 2.7.10, EC 2.7.10.2, FLJ22224, FLJ31718, FLJ41441, tyrosine-protein kinase ABL2, Tyrosine-protein kinase ARG, v-abl Abelson murine leukemia viral oncogene homolog 2 |
|---|
| Gene, Accession # | ABL2, Gene ID: 27 |
|---|
| Catalog # | NBP2-68946 |
|---|
| Price | |
|---|
| Order / More Info | ABL2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|