| Edit |   |
| Antigenic Specificity | TJAP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TJAP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TJAP1. This antibody reacts with human. The TJAP1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TJAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RLDCNLAVQLLKCNKSHFRNHKFADLPCELQDMVRKHLHSGQEAASPGPAPSLAPGAVVPTSVIARVLEKPESLLLNSAQS |
| Other Names | DKFZp686F06131, PILTTJP4tight junction protein 4 (peripheral), Protein incorporated later into tight junctions, tight junction associated protein 1 (peripheral), Tight junction protein 4, tight junction-associated protein 1 |
| Gene, Accession # | TJAP1, Gene ID: 93643, Accession: Q5JTD0 |
| Catalog # | NBP1-80902 |
| Price | |
| Order / More Info | TJAP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |