| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DC-LAMP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DC-LAMP Antibody from Novus Biologicals is a rabbit polyclonal antibody to DC-LAMP. This antibody reacts with human. The DC-LAMP Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DC-LAMP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNAT |
|---|
| Other Names | CD208 antigen, DC-LAMP, DCLAMPDC-lysosome-associated membrane glycoprotein, LAMP, LAMP-3, lysosomal-associated membrane protein 3DC LAMP, lysosome-associated membrane glycoprotein 3, Protein TSC403, TSC403CD208 |
|---|
| Gene, Accession # | LAMP3, Gene ID: 27074, Accession: Q9UQV4, SwissProt: Q9UQV4 |
|---|
| Catalog # | NBP2-33616 |
|---|
| Price | |
|---|
| Order / More Info | DC-LAMP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 28331853 |
|---|
| 产品资料 |
|
|