| Edit |   |
| Antigenic Specificity | RAB19B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RAB19B Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAB19B. This antibody reacts with human. The RAB19B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RAB19B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LIGNKCDLWEKRHVLFEDACTLAEKYGLLAVLETSAKES |
| Other Names | RAB19, member RAS oncogene family, RAB19BGTP-binding protein RAB19B, ras-related protein Rab-19 |
| Gene, Accession # | RAB19, Gene ID: 401409 |
| Catalog # | NBP2-13188 |
| Price | |
| Order / More Info | RAB19B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |