| Edit |   |
| Antigenic Specificity | RAB1B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RAB1B Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAB1B. This antibody reacts with human. The RAB1B Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is RAB1B - C-terminal region. Peptide sequence TSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGG. |
| Other Names | RAB1B, member RAS oncogene family, ras-related protein Rab-1B, small GTP-binding protein |
| Gene, Accession # | RAB1B, Gene ID: 81876, Accession: NP_112243, SwissProt: NP_112243 |
| Catalog # | NBP1-98500 |
| Price | |
| Order / More Info | RAB1B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |