| Edit |   |
|---|
| Antigenic Specificity | RAB39B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RAB39B Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAB39B. This antibody reacts with human. The RAB39B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RAB39B(RAB39B, member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB39B. Peptide sequence MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV. |
|---|
| Other Names | MRX72, RAB39B, member RAS oncogene family, ras-related protein Rab-39B |
|---|
| Gene, Accession # | RAB39B, Gene ID: 116442, Accession: Q96DA2, SwissProt: Q96DA2 |
|---|
| Catalog # | NBP1-58900-20ul |
|---|
| Price | |
|---|
| Order / More Info | RAB39B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|