| 产品详情 |
| Edit |   |
| Antigenic Specificity | B3GALNT1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The B3GALNT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to B3GALNT1. This antibody reacts with human. The B3GALNT1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to B3GALNT1(beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)) The peptide sequence was selected from the middle region of B3GALNT1. Peptide sequence PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDT |
| Other Names | b3Gal-T3, Beta-1,3-galactosyltransferase 3, Beta-1,3-GalNAc-T1, Beta-1,3-GalTase 3, beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group), Beta3GalT3, Beta3Gal-T3, beta-3-Gx-T3, brainiac1, EC 2.4.1.79, Galactosylgalactosylglucosylceramide beta-D-acetyl-galactosaminyltransferase, Gb4Cer, GLCT3, Globoside synthase, globotriaosylceramide 3-beta-N-acetylgalactosaminyltransferase, P, P antigen synthase, P blood group globoside, polypeptide 3 (Globosideblood group), UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1, UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 1(Globoside blood group), UDP-GalNAc:betaGlcNAc beta-1,3-galactosaminyltransferase, polypeptide 1(Globoside blood group), UDP-N-acetylgalactosamine:globotriaosylceramidebeta-1,3-N-acetylgalactosaminyltransferase |
| Gene, Accession # | B3GALNT1, Gene ID: 8706, Accession: O75752, SwissProt: O75752 |
| Catalog # | NBP1-59448 |
| Price | |
| Order / More Info | B3GALNT1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|