| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SETDB1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SETDB1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SETDB1. This antibody reacts with human. The SETDB1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SETDB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGTSRKPTAGQTSATAVDSDDIQTISSGSEGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQFYDGEESCY |
|---|
| Other Names | ERG-associated protein with SET domain, ESETEC 2.1.1.43, H3-K9-HMTase 4, Histone H3-K9 methyltransferase 4, histone-lysine N-methyltransferase SETDB1, histone-lysine N-methyltransferase, H3lysine-9 specific 4, KG1T, KIAA0067H3-K9-HMTase4, KMT1EERG-associated protein with a SET domain, ESET, Lysine N-methyltransferase 1E, SET domain bifurcated 1, SET domain, bifurcated 1 |
|---|
| Gene, Accession # | SETDB1, Gene ID: 9869 |
|---|
| Catalog # | NBP2-56678 |
|---|
| Price | |
|---|
| Order / More Info | SETDB1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|