| Edit |   |
| Antigenic Specificity | GTP-binding protein 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GTP-binding protein 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GTP-binding protein 1. This antibody reacts with human. The GTP-binding protein 1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The specific Immunogen is proprietary information. Peptide sequence ARLHGGFDSDCSEDGEALNGEPELDLTSKLVLVSPTSEQYDSLLRQMWER. |
| Other Names | GP1GTP-binding protein 1, GP-1MGC20069, G-protein 1, GTP binding protein 1, HSPC018 |
| Gene, Accession # | GTPBP1, Gene ID: 9567, Accession: NP_004277, SwissProt: NP_004277 |
| Catalog # | NBP1-79450 |
| Price | |
| Order / More Info | GTP-binding protein 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |