| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GTP binding protein era homolog |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GTP binding protein era homolog Antibody from Novus Biologicals is a rabbit polyclonal antibody to GTP binding protein era homolog. This antibody reacts with human. The GTP binding protein era homolog Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ERAL1(Era G-protein-like 1 (E. coli)) The peptide sequence was selected from the middle region of ERAL1. Peptide sequence KVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKS. |
|---|
| Other Names | CEGA, Conserved ERA-like GTPase, ERA, Era (E. coli G-protein homolog)-like 1, Era G-protein-like 1 (E. coli), ERAL1A, ERA-like protein 1, ERA-W, GTPase Era, mitochondrial, GTPase, human homolog of E. coli essential cell cycle protein Era, GTP-binding protein era homolog, HERA, H-ERA, HERA-A, HERA-B |
|---|
| Gene, Accession # | ERAL1, Gene ID: 26284, Accession: O75616, SwissProt: O75616 |
|---|
| Catalog # | NBP1-57493 |
|---|
| Price | |
|---|
| Order / More Info | GTP binding protein era homolog Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|