| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RNA Polymerase II/POLR2A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RNA Polymerase II/POLR2A Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNA Polymerase II/POLR2A. This antibody reacts with human. The RNA Polymerase II/POLR2A Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RNA Polymerase II/POLR2A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLS |
|---|
| Other Names | DNA-directed RNA polymerase II largest subunit, RNA polymerase II 220 kdsubunit, DNA-directed RNA polymerase II subunit A, DNA-directed RNA polymerase II subunit RPB1, DNA-directed RNA polymerase III largest subunit, EC 2.7.7.48, EC 2.7.7.6, hRPB220, hsRPB1, MGC75453, POLR2, POLRA, polymerase (RNA) II (DNA directed) polypeptide A (220kD), polymerase (RNA) II (DNA directed) polypeptide A, 220kDa, RNA Pol 2, RNA Polymerase 2, RNA polymerase II subunit B1, RNA-directed RNA polymerase II subunit RPB1, RNAPII, RPB1, RPBh1, RpIILS, RPO2, RPOL2 |
|---|
| Gene, Accession # | POLR2A, Gene ID: 5430 |
|---|
| Catalog # | NBP2-55663 |
|---|
| Price | |
|---|
| Order / More Info | RNA Polymerase II/POLR2A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|