| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UbcH5c/UBE2D3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UbcH5c/UBE2D3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UbcH5c/UBE2D3. This antibody reacts with human. The UbcH5c/UBE2D3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to UBE2D3(ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)) The peptide sequence was selected from the N terminal of UBE2D3. Peptide sequence MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF. |
|---|
| Other Names | E2(17)KB 3, E2(17)KB3, EC 6.3.2.19, MGC43926, MGC5416, UBC4/5, UBC5C, UBCH5C, Ubiquitin carrier protein D3, ubiquitin-conjugating enzyme E2 D3, Ubiquitin-conjugating enzyme E2(17)KB 3, Ubiquitin-conjugating enzyme E2-17 kDa 3, ubiquitin-conjugating enzyme E2D 3 (homologous to yeast UBC4/5), ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast), Ubiquitin-protein ligase D3 |
|---|
| Gene, Accession # | UBE2D3, Gene ID: 7323, Accession: P61077, SwissProt: P61077 |
|---|
| Catalog # | NBP1-55276 |
|---|
| Price | |
|---|
| Order / More Info | UbcH5c/UBE2D3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|