| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UbcH10/UBE2C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UbcH10/UBE2C Antibody from Novus Biologicals is a rabbit polyclonal antibody to UbcH10/UBE2C. This antibody reacts with human. The UbcH10/UBE2C Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human UbcH10/UBE2C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD |
|---|
| Other Names | cyclin-selective ubiquitin carrier protein, dJ447F3.2, EC 6.3.2.19, UbcH10, UBCH10mitotic-specific ubiquitin-conjugating enzyme, Ubiquitin carrier protein C, ubiquitin carrier protein E2-C, ubiquitin-conjugating enzyme E2 C, ubiquitin-conjugating enzyme E2C, Ubiquitin-protein ligase C |
|---|
| Gene, Accession # | UBE2C, Gene ID: 11065 |
|---|
| Catalog # | NBP2-56693 |
|---|
| Price | |
|---|
| Order / More Info | UbcH10/UBE2C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|