| Edit |   |
|---|
| Antigenic Specificity | Lgr4/GPR48 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Lgr4/GPR48 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Lgr4/GPR48. This antibody reacts with human. The Lgr4/GPR48 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KSHSCPALAVASCQRPEGYWSDCGTQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD |
|---|
| Other Names | GPR48G protein-coupled receptor 48, G-protein coupled receptor 48, leucine-rich repeat containing G protein-coupled receptor 4 |
|---|
| Gene, Accession # | LGR4, Gene ID: 55366, Accession: Q9BXB1, SwissProt: Q9BXB1 |
|---|
| Catalog # | NBP1-89737-25ul |
|---|
| Price | |
|---|
| Order / More Info | Lgr4/GPR48 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22855134 |
|---|