| 产品详情 |
| Edit |   |
| Antigenic Specificity | RNF144A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RNF144A Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF144A. This antibody reacts with human. The RNF144A Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RNF144A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQR YKKLQFEREVLFDPCRTWCPASTCQAVC |
| Other Names | EC 6.3.2, EC 6.3.2.-, KIAA0161UBCE7IP4probable E3 ubiquitin-protein ligase RNF144A, ring finger protein 144Aring finger protein 144, RNF144, UbcM4-interacting protein 4, ubiquitin conjugating enzyme 7 interacting protein 4, Ubiquitin-conjugating enzyme 7-interacting protein 4 |
| Gene, Accession # | RNF144A, Gene ID: 9781 |
| Catalog # | NBP2-13238 |
| Price | |
| Order / More Info | RNF144A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|