| 产品详情 |
| Edit |   |
| Antigenic Specificity | Complement Factor H-related 1/CFHR1/CFHL1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Complement Factor H-related 1/CFHR1/CFHL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Complement Factor H-related 1/CFHR1/CFHL1. This antibody reacts with human. The Complement Factor H-related 1/CFHR1/CFHL1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Complement Factor H-related 1/CFHR1/CFHL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCA |
| Other Names | CFHL1FHR-1, CFHLCFHR1P, complement factor H-related 1, complement factor H-related 1 pseudogene, complement factor H-related protein 1, FHR1CFHL1P, H factor (complement)-like 1, H factor (complement)-like 2, H factor-like protein 1, H36-1, H36-2, H-factor-like 1, HFL1H36, HFL2, MGC104329 |
| Gene, Accession # | CFHR1, Gene ID: 3078 |
| Catalog # | NBP2-14474 |
| Price | |
| Order / More Info | Complement Factor H-related 1/CFHR1/CFHL1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|