| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Complement Factor H-related 2/CFHR2/CFHL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Complement Factor H-related 2/CFHR2/CFHL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Complement Factor H-related 2/CFHR2/CFHL2. This antibody reacts with human. The Complement Factor H-related 2/CFHR2/CFHL2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Complement Factor H-related 2/CFHR2/CFHL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE |
|---|
| Other Names | CFHL2FHR-2, complement factor H-related 2, factor H-related gene 2, FHR2DDESK59, H factor (complement)-like 3, H factor-like 3, H factor-like protein 2, HFL3complement factor H-related protein 2 |
|---|
| Gene, Accession # | CFHR2, Gene ID: 3080 |
|---|
| Catalog # | NBP2-48947 |
|---|
| Price | |
|---|
| Order / More Info | Complement Factor H-related 2/CFHR2/CFHL2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|