| Edit |   |
|---|
| Antigenic Specificity | MPST |
|---|
| Clone | 1B5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA, Immunoprecipitation. This antibody is reactive against recombinant protein in ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MPST Antibody (1B5) from Novus Biologicals is a mouse monoclonal antibody to MPST. This antibody reacts with human. The MPST Antibody (1B5) has been validated for the following applications: ELISA, Immunoprecipitation. |
|---|
| Immunogen | MPST (NP_001013454.1, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIY |
|---|
| Other Names | mercaptopyruvate sulfurtransferase, MGC24539, MSThuman liver rhodanese, TST2EC 2.8.1.2,3-mercaptopyruvate sulfurtransferase |
|---|
| Gene, Accession # | MPST, Gene ID: 4357, Accession: NP_001013454, SwissProt: NP_001013454 |
|---|
| Catalog # | H00004357-M01 |
|---|
| Price | |
|---|
| Order / More Info | MPST Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|