| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MPV17L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MPV17L Antibody from Novus Biologicals is a rabbit polyclonal antibody to MPV17L. This antibody reacts with human. The MPV17L Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MPV17L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SQQSGDGTFKSAFTILYTKGTSATEGYPKK |
|---|
| Other Names | FLJ39599, MGC70356, M-LP homolog, M-LPH, MLPH1, MLPH2, MPV17 mitochondrial membrane protein-like, MPV17L1, mpv17-like protein, Mpv17-like protein type 1, Mpv17-like protein type 2 |
|---|
| Gene, Accession # | MPV17L, Gene ID: 255027 |
|---|
| Catalog # | NBP1-83466 |
|---|
| Price | |
|---|
| Order / More Info | MPV17L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|