| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MPZL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MPZL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MPZL1. This antibody reacts with human. The MPZL1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MPZL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN |
|---|
| Other Names | FLJ21047, immunoglobulin family transmembrane protein, MPZL1b, myelin protein zero-like 1, myelin protein zero-like protein 1, protein zero related, Protein zero-related, PZR1b, PZRb, PZRPZRa |
|---|
| Gene, Accession # | MPZL1, Gene ID: 9019 |
|---|
| Catalog # | NBP2-57487 |
|---|
| Price | |
|---|
| Order / More Info | MPZL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|