| Edit |   |
| Antigenic Specificity | MPV17L2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MPV17L2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MPV17L2. This antibody reacts with human. The MPV17L2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to FKSG24(hypothetical protein MGC12972) The peptide sequence was selected from the N terminal of FKSG24. Peptide sequence PFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLGLGC. |
| Other Names | FKSG24 |
| Gene, Accession # | MPV17L2, Gene ID: 84769, Accession: Q567V2, SwissProt: Q567V2 |
| Catalog # | NBP1-57632 |
| Price | |
| Order / More Info | MPV17L2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |