| Edit |   |
|---|
| Antigenic Specificity | CWC22 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CWC22 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CWC22. This antibody reacts with human. The CWC22 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to KIAA1604 (CWC22 spliceosome-associated protein homolog (S. cerevisiae)) The peptide sequence was selected from the C terminal of KIAA1604. Peptide sequence RSKSKEMNRKHSGSRSDEDRYQNGAERRWEKSSRYSEQSRESKKNQD |
|---|
| Other Names | CWC22 spliceosome-associated protein homolog (S. cerevisiae), EIF4GL, fSAPbpre-mRNA-splicing factor CWC22 homolog, KIAA1604NCMfunctional spliceosome-associated protein b, Nucampholin homolog |
|---|
| Gene, Accession # | CWC22, Gene ID: 57703, Accession: Q9HCG8, SwissProt: Q9HCG8 |
|---|
| Catalog # | NBP1-69211-20ul |
|---|
| Price | |
|---|
| Order / More Info | CWC22 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|