| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP6V0A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | unpurified, no preservative |
|---|
| Size | 0.05 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. The quality control of this antibody is limited to WB on the immunizing protein. It has been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP6V0A1 Antibody from Novus Biologicals is a mouse polyclonal antibody to ATP6V0A1. This antibody reacts with human. The ATP6V0A1 Antibody has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ATP6V0A1 (NP_005168 212 a.a. - 298 a.a.) partial recombinant protein with GST tag. GDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVR |
|---|
| Other Names | a1, ATP6N1, ATP6N1AATPase, H+ transporting, lysosomal non-catalytic accessory protein 1(110/116kD), ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalyticaccessory protein 1A (110/116kD), ATPase, H+ transporting, lysosomal V0 subunit a isoform 1, ATPase, H+ transporting, lysosomal V0 subunit a1, Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit, DKFZp781J1951, Stv1, Vacuolar adenosine triphosphatase subunit Ac116, Vacuolar proton pump subunit 1, vacuolar proton pump, subunit 1, vacuolar proton translocating ATPase 116 kDa subunit A, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1, vacuolar-type H(+)-ATPase 115 kDa subunit, V-ATPase 116 kDa, V-ATPase 116 kDa isoform a1, Vph1, VPP1H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1, V-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 1 |
|---|
| Gene, Accession # | ATP6V0A1, Gene ID: 535, Accession: NP_005168, SwissProt: NP_005168 |
|---|
| Catalog # | H00000535-A01 |
|---|
| Price | |
|---|
| Order / More Info | ATP6V0A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26944496 |
|---|
| 产品资料 |
|
|