| 产品详情 |
| Edit |   |
| Antigenic Specificity | ATP6V0A2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ATP6V0A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP6V0A2. This antibody reacts with human, mouse. The ATP6V0A2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. This product is specific to Subunit or Isoform: a isoform 2 |
| Immunogen | Synthetic peptides corresponding to ATP6V0A2(ATPase, H+ transporting, lysosomal V0 subunit a2) The peptide sequence was selected from the N terminal of ATP6V0A2. Peptide sequence INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN. |
| Other Names | A2, ARCL, ATP6a2, ATP6N1D, ATPase, H+ transporting, lysosomal V0 subunit a isoform 2, ATPase, H+ transporting, lysosomal V0 subunit a2, infantile malignant osteopetrosis, J6B7, Lysosomal H(+)-transporting ATPase V0 subunit a2, regeneration and tolerance factor, RTF, STV1, TJ6A2V-ATPase, TJ6M, TJ6S, vacuolar proton translocating ATPase 116 kDa subunit a, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 2, v-ATPase 116 kDa, V-ATPase 116 kDa isoform a2, Vph1, v-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 2, WSS |
| Gene, Accession # | ATP6V0A2, Gene ID: 23545, Accession: Q9Y487, SwissProt: Q9Y487 |
| Catalog # | NBP1-59069 |
| Price | |
| Order / More Info | ATP6V0A2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|