| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP6V1A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP6V1A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP6V1A. This antibody reacts with human. The ATP6V1A Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: A |
|---|
| Immunogen | Synthetic peptides corresponding to ATP6V1A(ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A) The peptide sequence was selected from the N terminal of ATP6V1A. Peptide sequence SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR. |
|---|
| Other Names | 70kD, isoform 1, ATP6A1, ATP6V1A1ATPase, H+ transporting, lysosomal, subunit A1, ATPase, H+ transporting, lysosomal (vacuolar proton pump), alpha polypeptide, ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A, EC 3.6.3, EC 3.6.3.14, H(+)-transporting two-sector ATPase, subunit A, H+-transporting ATPase chain A, vacuolar (VA68 type), HO68, VA68, vacuolar ATP synthase catalytic subunit A, ubiquitous isoform, Vacuolar ATPase isoform VA68, vacuolar proton pump alpha subunit 1, Vacuolar proton pump subunit alpha, V-ATPase 69 kDa subunit, V-ATPase 69 kDa subunit 1, V-ATPase A subunit 1, V-ATPase subunit A, Vma1, VPP2, V-type proton ATPase catalytic subunit A |
|---|
| Gene, Accession # | ATP6V1A, Gene ID: 523, Accession: P38606, SwissProt: P38606 |
|---|
| Catalog # | NBP1-55212 |
|---|
| Price | |
|---|
| Order / More Info | ATP6V1A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|