| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KIF21A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KIF21A Antibody from Novus Biologicals is a rabbit polyclonal antibody to KIF21A. This antibody reacts with human. The KIF21A Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human KIF21A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QKEAQIKVLEGRLKQTEITSATQNQLLFHMLKEKAELNPELDALLGHALQDLDSVPLENVEDSTDEDAPLNS |
|---|
| Other Names | CFEOM1, CFEOM3B, FEOM1, FEOM3A, fibrosis of the extraocular muscles, congenital, 1, FLJ20052, KIAA1708DKFZp779C159, KIF2, kinesin family member 21A, Kinesin-like protein KIF2, kinesin-like protein KIF21A, Renal carcinoma antigen NY-REN-62 |
|---|
| Gene, Accession # | KIF21A, Gene ID: 55605, Accession: Q7Z4S6, SwissProt: Q7Z4S6 |
|---|
| Catalog # | NBP2-37969 |
|---|
| Price | |
|---|
| Order / More Info | KIF21A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|