| Edit |   |
|---|
| Antigenic Specificity | KIF26A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KIF26A Antibody from Novus Biologicals is a rabbit polyclonal antibody to KIF26A. This antibody reacts with human. The KIF26A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human KIF26A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VAVADTVRECPPVAGPDGLSKAWGRGGVCTSALVTPTPGSVGGSTGPSAAASFFIRAMQKLSLASKRKKP |
|---|
| Other Names | DKFZp434N178, FLJ22753, KIAA1236DKFZP434N178, KIF26A variant protein, kinesin family member 26A, kinesin-like protein KIF26A |
|---|
| Gene, Accession # | KIF26A, Gene ID: 26153, Accession: Q9ULI4, SwissProt: Q9ULI4 |
|---|
| Catalog # | NBP2-38891 |
|---|
| Price | |
|---|
| Order / More Info | KIF26A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|