| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | VPS53 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VPS53 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VPS53. This antibody reacts with human, mouse, rat. The VPS53 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat VPS53 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGSLSLTAPTPEQESSRIRKLEKLIK |
|---|
| Other Names | FLJ10979, FLJ41112, FLJ61757, HCCS1, hVps53L, MGC39512, pp13624, vacuolar protein sorting 53 (yeast), vacuolar protein sorting 53 homolog (S. cerevisiae), vacuolar protein sorting-associated protein 53 homolog |
|---|
| Gene, Accession # | VPS53, Gene ID: 55275 |
|---|
| Catalog # | NBP1-83798 |
|---|
| Price | |
|---|
| Order / More Info | VPS53 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|