| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KIF21B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID: 30479371). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KIF21B Antibody from Novus Biologicals is a rabbit polyclonal antibody to KIF21B. This antibody reacts with human, mouse. The KIF21B Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human KIF21B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RKTQEVSALRRLAKPMSERVAGRAGLKPPMLDSGAEVSASTTSSEAESGARSVSSIVRQWNRKINHFLGDHPAPTVNGTRPARKKFQKKG |
|---|
| Other Names | FLJ16314, KIAA0449, kinesin family member 21B |
|---|
| Gene, Accession # | KIF21B, Gene ID: 23046 |
|---|
| Catalog # | NBP1-84188 |
|---|
| Price | |
|---|
| Order / More Info | KIF21B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 30479371 |
|---|
| 产品资料 |
|
|