| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CCL23/Ck beta 8-1/MIP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCL23/Ck beta 8-1/MIP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCL23/Ck beta 8-1/MIP3. This antibody reacts with human. The CCL23/Ck beta 8-1/MIP3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CCL23/Ck beta 8-1/MIP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NPVLLDMLWRRKIGPQMTLSHAAGFHATSADCCISYTPRSIPCSLLESYFETNS |
|---|
| Other Names | C6 beta-chemokine, chemokine (C-C motif) ligand 23, CKb8, CKB-8, CK-beta-8, hmrp-2a, Macrophage inflammatory protein 3, MIP3, MIP-3CK-BETA-8, MPIF1, MPIF-1Ckb-8-1, Myeloid progenitor inhibitory factor 1, SCYA23C-C motif chemokine 23, small inducible cytokine subfamily A (Cys-Cys), member 23, Small-inducible cytokine A23 |
|---|
| Gene, Accession # | CCL23, Gene ID: 6368 |
|---|
| Catalog # | NBP1-88079 |
|---|
| Price | |
|---|
| Order / More Info | CCL23/Ck beta 8-1/MIP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|