| Edit |   |
|---|
| Antigenic Specificity | ATG16L2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATG16L2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATG16L2. This antibody reacts with human. The ATG16L2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ATG16L2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLATGGADRLIHLWNVVGSRLEANQTLEGAGGSITSVDFDPSGYQVLAATYNQAAQLWKVGEAQSKETLSGHKDKVTAAKFKLTRHQAVTGS |
|---|
| Other Names | APG16-like 2, ATG16 autophagy related 16-like 2 (S. cerevisiae), ATG16B, autophagy-related protein 16-2, FLJ00012, WDR80WD repeat-containing protein 80 |
|---|
| Gene, Accession # | ATG16L2, Gene ID: 89849 |
|---|
| Catalog # | NBP2-58308 |
|---|
| Price | |
|---|
| Order / More Info | ATG16L2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|