| Edit |   |
| Antigenic Specificity | Atlastin-3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Atlastin-3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Atlastin-3. This antibody reacts with human. The Atlastin-3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to DKFZP564J0863 The peptide sequence was selected from the middle region of DKFZP564J0863. Peptide sequence DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA. |
| Other Names | atlastin 3, atlastin GTPase 3, atlastin-3, DKFZP564J0863, EC 3.6.5.- |
| Gene, Accession # | ATL3, Gene ID: 25923, Accession: Q6DD88, SwissProt: Q6DD88 |
| Catalog # | NBP1-59034-20ul |
| Price | |
| Order / More Info | Atlastin-3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |