| Edit |   |
|---|
| Antigenic Specificity | alpha 1B-Glycoprotein |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. HIER (Citrate buffer pH 6.0) recommended for IHC-P |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The alpha 1B-Glycoprotein Antibody from Novus Biologicals is a rabbit polyclonal antibody to alpha 1B-Glycoprotein. This antibody reacts with human. The alpha 1B-Glycoprotein Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human A1BG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SESLLKPLANVTLTCQARLETPDFQLFKNGVAQEPVHLDSPAIKHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPWLSM |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | A1BG, Accession: P04217, SwissProt: P04217 |
|---|
| Catalog # | NBP2-33419 |
|---|
| Price | |
|---|
| Order / More Info | alpha 1B-Glycoprotein Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|