| Edit |   |
|---|
| Antigenic Specificity | alpha 1B-Glycoprotein |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The alpha 1B-Glycoprotein Antibody from Novus Biologicals is a rabbit polyclonal antibody to alpha 1B-Glycoprotein. This antibody reacts with human. The alpha 1B-Glycoprotein Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to A1BG(alpha-1-B glycoprotein) The peptide sequence was selected from the N terminal of A1BG (NP_570602). Peptide sequence ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG. |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | A1BG, Accession: P04217, SwissProt: P04217 |
|---|
| Catalog # | NBP1-57969-20ul |
|---|
| Price | |
|---|
| Order / More Info | alpha 1B-Glycoprotein Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|