| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | alpha-1D Adrenergic R/ADRA1D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The alpha-1D Adrenergic R/ADRA1D Antibody from Novus Biologicals is a rabbit polyclonal antibody to alpha-1D Adrenergic R/ADRA1D. This antibody reacts with human. The alpha-1D Adrenergic R/ADRA1D Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human alpha-1D Adrenergic R/ADRA1D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEVAEGATCQAYELADYSNLRE |
|---|
| Other Names | ADRA1, ADRA1ADAR, ADRA1R, adrenergic, alpha -1D-, receptor, adrenergic, alpha-1A-, receptor, adrenergic, alpha-1D-, receptor, ALPHA1, Alpha-1A adrenergic receptor, alpha-1D adrenergic receptor, Alpha-1D adrenoceptor, Alpha-1D adrenoreceptor, alpha-1D-adrenergic receptor, Alpha-adrenergic receptor 1a, dJ779E11.2 |
|---|
| Gene, Accession # | ADRA1D, Gene ID: 146 |
|---|
| Catalog # | NBP1-90229 |
|---|
| Price | |
|---|
| Order / More Info | alpha-1D Adrenergic R/ADRA1D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|