| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LKB1/STK11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LKB1/STK11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LKB1/STK11. This antibody reacts with human. The LKB1/STK11 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human LKB1/STK11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIR |
|---|
| Other Names | EC 2.7.11.1, LKB1 serine/threonine kinase 11 (Peutz-Jeghers syndrome), PJS, PJS polarization-related protein LKB1, Renal carcinoma antigen NY-REN-19, serine/threonine kinase 11, serine/threonine-protein kinase 11, Serine/threonine-protein kinase LKB1, STK11 |
|---|
| Gene, Accession # | STK11, Gene ID: 6794 |
|---|
| Catalog # | NBP2-56895 |
|---|
| Price | |
|---|
| Order / More Info | LKB1/STK11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|