| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Patched 1/PTCH |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Patched 1/PTCH Antibody from Novus Biologicals is a rabbit polyclonal antibody to Patched 1/PTCH. This antibody reacts with human. The Patched 1/PTCH Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Patched 1/PTCH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVVHPESRHHPPSNPRQQPHLDS |
|---|
| Other Names | BCNSFLJ42602, FLJ26746, HPE7, NBCCS, patched (Drosophila) homolog, patched 1, patched homolog (Drosophila), patched homolog 1, patched homolog 1 (Drosophila), protein patched homolog 1, PTC, PTC1, PTCH, PTCH protein +12b, PTCH protein +4', PTCH protein -10, PTCH11 |
|---|
| Gene, Accession # | PTCH1, Gene ID: 5727 |
|---|
| Catalog # | NBP2-57927 |
|---|
| Price | |
|---|
| Order / More Info | Patched 1/PTCH Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|