| Edit |   |
| Antigenic Specificity | Fbl14 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Fbl14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Fbl14. This antibody reacts with human. The Fbl14 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human FBXL14. Peptide sequence WRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSY. |
| Other Names | FBL14, F-box and leucine-rich repeat protein 14 |
| Gene, Accession # | FBXL14, Gene ID: 144699, Accession: NP_689654, SwissProt: NP_689654 |
| Catalog # | NBP1-79520 |
| Price | |
| Order / More Info | Fbl14 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |