| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | F box protein 38 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The F box protein 38 Antibody from Novus Biologicals is a rabbit polyclonal antibody to F box protein 38. This antibody reacts with human. The F box protein 38 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human F box protein 38 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEENDFRQDLQPGEQQFAADALNEMEDIVQEDGEVVAESGNNTPAHSQAIIPVDVDEEQAGPSGLQRVVKPTSITVHDSESDDEEDSLELQEVWIPKN |
|---|
| Other Names | F-box only protein 38, F-box protein 38, FBX38, FLJ13962, Modulator of KLF7 activity homolog, MoKA, MOKAFbx38, SP329 |
|---|
| Gene, Accession # | FBXO38, Gene ID: 81545 |
|---|
| Catalog # | NBP2-58958 |
|---|
| Price | |
|---|
| Order / More Info | F box protein 38 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|