| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Alpha Fodrin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Alpha Fodrin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Alpha Fodrin. This antibody reacts with human, mouse, rat. The Alpha Fodrin Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to SPTAN1(spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)) The peptide sequence was selected from the N terminal of SPTAN1. Peptide sequence MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ. |
|---|
| Other Names | Alpha-II spectrin, EIEE5, FLJ17738, FLJ44613, Fodrin alpha chain, NEAS, spectrin alpha chain, brain, spectrin, alpha, non-erythrocytic 1 (alpha-fodrin), Spectrin, non-erythroid alpha chain, SPTA2 |
|---|
| Gene, Accession # | SPTAN1, Gene ID: 6709, Accession: Q13813, SwissProt: Q13813 |
|---|
| Catalog # | NBP1-53093 |
|---|
| Price | |
|---|
| Order / More Info | Alpha Fodrin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|