| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | alpha 2-Macroglobulin |
|---|
| Clone | 2B5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Proximity Ligation Assay. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The alpha 2-Macroglobulin Antibody (2B5) from Novus Biologicals is a mouse monoclonal antibody to alpha 2-Macroglobulin. This antibody reacts with human. The alpha 2-Macroglobulin Antibody (2B5) has been validated for the following applications: Western Blot, ELISA, Proximity Ligation Assay. |
|---|
| Immunogen | A2M (NP_000005.2, 641 a.a. - 730 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET |
|---|
| Other Names | alpha-2-M, alpha-2-macroglobulin, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5, CPAMD5DKFZp779B086, FWP007, S863-7 |
|---|
| Gene, Accession # | A2M, Gene ID: 2, Accession: NP_000005, SwissProt: NP_000005 |
|---|
| Catalog # | H00000002-M03 |
|---|
| Price | |
|---|
| Order / More Info | alpha 2-Macroglobulin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|